Pay in 4 interest-free payments of $204.68 Learn more
Ships within 48 hours · Estimated delivery Aug 10 - Aug 15
Feinstein E
a general chromatin factor that acts to reorganize nucleosomes
"Schaefer L
Expression Region: 1-373aa
Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial DNA Gel Stain and Loading Buffer Feinstein ESize: 200ug. Other sizes are also available. Please Inquire. In Stock: No Lead time: 22 32 working days Research Topic: Others Uniprot ID: P0C741 Gene Names: LMP1 Organism: Epstein Barr virus (strain GD1) (HHV 4) (Human herpesvirus 4) AA Sequence: YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD Expression Region: 185
US$ 15.99
US$ 149.50
US$ 11.99
US$ 15.99
US$ 22.99
US$ 14.99
